Search by Month
- June 2024 (4)
- May 2024 (92)
- April 2024 (85)
- March 2024 (109)
- February 2024 (120)
- January 2024 (162)
- December 2023 (140)
- November 2023 (146)
- October 2023 (151)
- September 2023 (143)
- August 2023 (161)
- July 2023 (156)
- June 2023 (156)
- May 2023 (153)
- April 2023 (139)
- March 2023 (152)
- February 2023 (135)
- January 2023 (172)
- December 2022 (182)
- November 2022 (186)
- October 2022 (140)
- January 2021 (94)
- December 2020 (77)
- November 2020 (106)
- October 2020 (105)
- September 2020 (101)
- August 2020 (105)
- July 2020 (103)
- June 2020 (114)
- May 2020 (1627)
- April 2020 (1668)
- March 2020 (1700)
- February 2020 (1569)
- January 2020 (1164)
- December 2019 (1460)
- November 2019 (1763)
- October 2019 (3123)
- September 2019 (2387)
- August 2019 (2595)
- July 2019 (2627)
- June 2019 (175)
- May 2019 (195)
- April 2019 (169)
- March 2019 (715)
- February 2019 (956)
- January 2019 (376)
- December 2018 (745)
- November 2018 (959)
- October 2018 (5071)
- September 2018 (520)
Pick a day
| M | T | W | T | F | S | S |
|---|---|---|---|---|---|---|
| « Jun | ||||||
| 1 | 2 | |||||
| 3 | 4 | 5 | 6 | 7 | 8 | 9 |
| 10 | 11 | 12 | 13 | 14 | 15 | 16 |
| 17 | 18 | 19 | 20 | 21 | 22 | 23 |
| 24 | 25 | 26 | 27 | 28 | 29 | 30 |
| 31 | ||||||
HD Premium Porn
- Veronica Da Souza Takes Messy Facial August 17, 2026Take a look back at athletic European starlet Veronica Da Souza and her incredible living room scene from Outta Control! This review breaks down her intense 24-minute performance, showcasing her natural 34D curves, gorgeous high heels, deep throat action, and an athletic anal sequence that builds toward a messy, explicit facial climax.
- Czech Tera Joy Enjoys Intense Anal Sex August 15, 2026Revisit one of the most memorable bedroom encounters from European starlet Tera Joy! This targeted scene review spotlights her unforgettable 27-minute chapter in Whores, detailing her natural 34C curves, slick oral deep throating, and a relentless, hard-hitting anal sex finale that culminates in an explicit, messy fluid finish.
- Busty Brazilian Taty Ninfa Gets Her Holes Stuffed August 13, 2026Take a look back at curvy Brazilian bombshell Taty Ninfa and her legendary bedroom scene from Anal Heaven! This focused review breaks down her intense 23-minute performance, showcasing enhanced curves, elegant high heels, deep throat action, and an athletic, explicit anal sex sequence that concludes with a stunning close-up fluid finish.
- Pretty Suzie Diamond Takes a Cock Up Her Ass August 11, 2026Dive into a sizzling bedroom encounter with the stunning, petite Suzie Diamond! Sporting nothing but gorgeous high heels, she delivers a mind-blowing 30-minute performance from Whores. Packed with deep throat action, sensual positions, and high-impact anal sex, this classic encounter finishes with a wild, explicit close-up climax.
- Tiny Brazilian Sol De Verao Rides Cock August 9, 2026Get ready for an uninhibited performance with petite brunette starlet Sol De Verao! This focused review breaks down her legendary 24-minute couch encounter from Musa do Brasil, showcasing seductive stripping, wet oral play, athletic cowgirl positions, and a high-impact anal sex sequence that builds toward a stunning, explicit cum on tits climax.
LETSDOEIT – Hardcore torture session in MMF threesome
Categories:
3 some3wayBDSMbigbig boobbig boobedbig boobsbig bootybig naturalbig natural titsbig titbig titsbigtitsbondagebrunettebrunnetebrunnettebrutalbrutallychokechokingclampsdildodirty talkdirty talkingdoedoe projectsdoeprojectsdominantdominatedominateddominationdominatrixfingerfinger fuckingfingeringgaghardhardcoreHumiliationLets Doe ItLetsDoeItmasterbatemasturbatemasturbate dildomasturbatesmasturbatingmasturbationmilfmmfoutdoorPick Uppickuppornporn doePornDoe PremiumPorndoePremiumporntube-bigtitsscreamscreamingshavedshaved pussyslapslaveslipperyspankedspankingsquirtsquirtingsquirting orgasmsquirting pussystockingstockingssubmissionsubmissivetattootattooedtattoosthree somethreesomethreesomesthresometiedtied uptittit torturetittiestortureVideoswetWet Pussywhipping
Model: Ex Girlfriend
Not enough porn? Yes, you can! Just click and enjoy!
- Big Tits Free Cams
- Real Sex
- Fresh Big Tits
- Hell Of BDSM
- Old n Fat Movies
- Mature Women Sex Cams
- Old nFat
- Milfs Wild Holiday
- Hardcore Matures
- Live Big Tits
- Live Toys
- Live BDSM
- Older Woman Sex Videos
- Fuck Mature
- Grannies Fucked
- Its Live
- All Porn Sites Pass
- Lingerie Queens
- Live Shaved Pussy
- Group Sex Frenzy
- Raw Banging
- Raw XXX Movies
- Pornstar Elite
- Big Tit Queens
- Live Brunette Girls
- New Cocks For My Wife
- Stocking Sex Videos
- Gangbanged Babes
- Sinful Mature Sex
- Live Brunettes Sex
- Granny Ultra
- Mature ExGf
- Porn Video Station
- Sinful Spanking
- Stockings Babes
- Phat Sexy Ass
- HD Hardcore
- Raw Pornstar Movies
- Sex Movies
- Big Tits Sex Movies
- Live Mature
- Live Couples Sex
- Milfs Ultra
- Sex Toys Porno
- Live Huge Tits
- Step Daughter Fuck
- Big Breasts Sex
- Love The Pink
- Milfs Bang
- Big Tits ExGf
- Wild Teen Parties
- Pornstar House
- Milf ExGf
- Big Bush Fetish Compilation June 27, 2024
- Cougar Shalina casting anal pour la prof June 27, 2024
- 再編集229Viva Erotic素人個人撮影 Patience juice-Amateur personal shooting June 27, 2024
- Tattooed Big Booty Shemale Rosy Pinheiro Jerks off with a Dildo up Her Ass June 27, 2024
- Hot wife loves when i talk dirty in arabic June 27, 2024
- ANGELA WHITE – Threesome with Lena the Plug and Adam 22 June 27, 2024
- Latina With Big Ass and Boobs Gets Fucked by Spanish Stud June 26, 2024
- innocently sits on the penis and moans with pleasure June 26, 2024
- Two sexy students ride their hairy professor bareback during spring break June 26, 2024




